PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G039700.1
Common NamePHAVU_002G039700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 911aa    MW: 101288 Da    PI: 4.6126
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G039700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding315.9e-10771814146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+W++++ e +++a+++lG++ ++ I + ++  +t+ q+k+++ k
  Phvul.002G039700.1 771 RGKWSKQDTEVFYEAIRELGTD-FSMIQQLFP-DKTRRQIKLKYKK 814
                         89********************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.65E-10761815IPR009057Homeodomain-like
PfamPF159632.6E-25766848No hitNo description
PROSITE profilePS500906.086766816IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.8E-6767814IPR009057Homeodomain-like
SMARTSM007175.6E-9770818IPR001005SANT/Myb domain
CDDcd001672.25E-6773814No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 911 aa     Download sequence    Send to blast
MDPFDDLLPV ASVERIRPGA KFVPKAKPKQ RRKEVPSSEK ATSSRDGLTG NECQNVVAST  60
LSVPAEESMG SIHHTQLEFP NSEREVPKQI SVEGDGAASV HDSTFTDADQ NSTYFLESAC  120
EADPTEFDGD SVTNFFSETN LNNGITQPVH PANAVETKLN NVTAPFTTCS NIDRMKEPPK  180
NGEGSFLDSN KCLELIDNSL QVGTELGFKS ASDNKVAIVQ TVDSNSNFGK EPELVSAEIE  240
LDPFSDILPD LPTRNVHKFK PKIKPRPRVG NMPASASANV MMEKSVELPT FSTTDFQSFQ  300
SSGILNQTTS LPLPTSEILT TNYLPSNFGD TSSNVPISED SKSLAAATPS QLDSLNAMLL  360
GDAVHNGTRD WPSAFGKSSG EATDIFCGLE SLDDFLAQAT TDTGKPALHS FNEKGAEENF  420
VAPACSSINS FGECDTTQVQ RCPEYHTPQD PVTFNEATIL NENDTHTNNR MSETEEIVDL  480
NPTYTRDDVF DYQSMKSGED PTSGILVHED LTNAADSSTL ADFLHANDSR EKEDANQRKK  540
DGTDSCSLRK NKRSSIAGEE DNGGKTLRQR RKLAASKPAN SSLNEDVEDD NDLDPPYHSN  600
EHELEENDDD CEVDHSSKKK RGSKSSQKKS VPKSGKTSQK RKKADDDVQK TKEPPKKFSH  660
STRRKKRCVD KALLEIPEDE LDPRTLPIKD IILLAEHRER QAKKEAMASN TTPSNQSAGD  720
FLHEAGAYNE QEFSGSEDGR DPYDDDQDNE RIESTSILYN YQTLMEKRPR RGKWSKQDTE  780
VFYEAIRELG TDFSMIQQLF PDKTRRQIKL KYKKEEREHY LRLRDAIHNR SKDHSHYKLL  840
IERLQQASTK EEEVVDLTEG TNEEVVEVAT TIKHDADVKA QEDSVAAESP EKSDDSEDES  900
LKWTEYKSLY *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-162AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007157057.10.0hypothetical protein PHAVU_002G039700g
TrEMBLV7CJG90.0V7CJG9_PHAVU; Uncharacterized protein
STRINGGLYMA11G01285.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36662938
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.15e-45MYB_related family protein